Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 73 pts. 9,942
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,940
  4. Avatar for Contenders 4. Contenders 36 pts. 9,935
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,926
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,869
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,823
  9. Avatar for Russian team 9. Russian team 4 pts. 9,733
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,503

  1. Avatar for bcre8tvv 51. bcre8tvv Lv 1 14 pts. 9,662
  2. Avatar for WBarme1234 52. WBarme1234 Lv 1 14 pts. 9,662
  3. Avatar for pvc78 53. pvc78 Lv 1 13 pts. 9,662
  4. Avatar for Flagg65a 54. Flagg65a Lv 1 12 pts. 9,649
  5. Avatar for guineapig 55. guineapig Lv 1 12 pts. 9,645
  6. Avatar for Anfinsen_slept_here 56. Anfinsen_slept_here Lv 1 11 pts. 9,643
  7. Avatar for manu8170 57. manu8170 Lv 1 11 pts. 9,640
  8. Avatar for Skippysk8s 58. Skippysk8s Lv 1 10 pts. 9,634
  9. Avatar for caglar 59. caglar Lv 1 10 pts. 9,627
  10. Avatar for georg137 60. georg137 Lv 1 9 pts. 9,625

Comments