Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for xkcd 13. xkcd 1 pt. 8,671
  3. Avatar for Window Group 14. Window Group 1 pt. 8,188
  4. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  5. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663

  1. Avatar for MicElephant 61. MicElephant Lv 1 9 pts. 9,618
  2. Avatar for Vinara 62. Vinara Lv 1 8 pts. 9,613
  3. Avatar for tony46 63. tony46 Lv 1 8 pts. 9,608
  4. Avatar for dbuske 64. dbuske Lv 1 8 pts. 9,571
  5. Avatar for deLaCeiba 65. deLaCeiba Lv 1 7 pts. 9,503
  6. Avatar for anthion 66. anthion Lv 1 7 pts. 9,479
  7. Avatar for smholst 67. smholst Lv 1 6 pts. 9,479
  8. Avatar for johngran 68. johngran Lv 1 6 pts. 9,474
  9. Avatar for Deleted player 69. Deleted player pts. 9,470
  10. Avatar for Keresto 70. Keresto Lv 1 5 pts. 9,457

Comments