Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 73 pts. 9,942
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,940
  4. Avatar for Contenders 4. Contenders 36 pts. 9,935
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,926
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,869
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,823
  9. Avatar for Russian team 9. Russian team 4 pts. 9,733
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,503

  1. Avatar for MicElephant 61. MicElephant Lv 1 9 pts. 9,618
  2. Avatar for Vinara 62. Vinara Lv 1 8 pts. 9,613
  3. Avatar for tony46 63. tony46 Lv 1 8 pts. 9,608
  4. Avatar for dbuske 64. dbuske Lv 1 8 pts. 9,571
  5. Avatar for deLaCeiba 65. deLaCeiba Lv 1 7 pts. 9,503
  6. Avatar for anthion 66. anthion Lv 1 7 pts. 9,479
  7. Avatar for smholst 67. smholst Lv 1 6 pts. 9,479
  8. Avatar for johngran 68. johngran Lv 1 6 pts. 9,474
  9. Avatar for Deleted player 69. Deleted player pts. 9,470
  10. Avatar for Keresto 70. Keresto Lv 1 5 pts. 9,457

Comments