Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 9,401
  2. Avatar for Richard Dawkins Foundation 12. Richard Dawkins Foundation 1 pt. 8,743
  3. Avatar for xkcd 13. xkcd 1 pt. 8,671
  4. Avatar for Window Group 14. Window Group 1 pt. 8,188
  5. Avatar for Bioquimica Biotec UFRJ 2017-1 15. Bioquimica Biotec UFRJ 2017-1 1 pt. 8,145
  6. Avatar for BioChem22017 16. BioChem22017 1 pt. 8,078
  7. Avatar for DSN @ Home 17. DSN @ Home 1 pt. 7,663
  1. Avatar for mimi 71. mimi Lv 1 5 pts. 9,436
  2. Avatar for SaraL 72. SaraL Lv 1 5 pts. 9,409
  3. Avatar for joanieg 73. joanieg Lv 1 5 pts. 9,402
  4. Avatar for Mr_Jolty 74. Mr_Jolty Lv 1 4 pts. 9,401
  5. Avatar for TastyMunchies 75. TastyMunchies Lv 1 4 pts. 9,400
  6. Avatar for Bushman 76. Bushman Lv 1 4 pts. 9,395
  7. Avatar for SKSbell 77. SKSbell Lv 1 4 pts. 9,388
  8. Avatar for uihcv 78. uihcv Lv 1 4 pts. 9,380
  9. Avatar for phi16 79. phi16 Lv 1 3 pts. 9,293
  10. Avatar for dssb 80. dssb Lv 1 3 pts. 9,279

Comments