Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 73 pts. 9,942
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,940
  4. Avatar for Contenders 4. Contenders 36 pts. 9,935
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,926
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,869
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,823
  9. Avatar for Russian team 9. Russian team 4 pts. 9,733
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,503
  1. Avatar for mimi 71. mimi Lv 1 5 pts. 9,436
  2. Avatar for SaraL 72. SaraL Lv 1 5 pts. 9,409
  3. Avatar for joanieg 73. joanieg Lv 1 5 pts. 9,402
  4. Avatar for Mr_Jolty 74. Mr_Jolty Lv 1 4 pts. 9,401
  5. Avatar for TastyMunchies 75. TastyMunchies Lv 1 4 pts. 9,400
  6. Avatar for Bushman 76. Bushman Lv 1 4 pts. 9,395
  7. Avatar for SKSbell 77. SKSbell Lv 1 4 pts. 9,388
  8. Avatar for uihcv 78. uihcv Lv 1 4 pts. 9,380
  9. Avatar for phi16 79. phi16 Lv 1 3 pts. 9,293
  10. Avatar for dssb 80. dssb Lv 1 3 pts. 9,279

Comments