Placeholder image of a protein
Icon representing a puzzle

1371: Revisiting Puzzle 97: Pig

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
April 27, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This saposin protein from pig serves as an activator for lipid-desolving enzymes. This protein contains six cysteines that oxidize to form three disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


GYFCESCRKIIQKLEDMVGPQPNEDTVTQAASQVCDKLKILRGLCKKIMRSFLRRISWDILTGKKPQAICVDIKICKE

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 9,997
  2. Avatar for Go Science 2. Go Science 73 pts. 9,942
  3. Avatar for Gargleblasters 3. Gargleblasters 52 pts. 9,940
  4. Avatar for Contenders 4. Contenders 36 pts. 9,935
  5. Avatar for Anthropic Dreams 5. Anthropic Dreams 24 pts. 9,926
  6. Avatar for Void Crushers 6. Void Crushers 16 pts. 9,869
  7. Avatar for HMT heritage 7. HMT heritage 10 pts. 9,859
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 9,823
  9. Avatar for Russian team 9. Russian team 4 pts. 9,733
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,503
  1. Avatar for ZeroLeak7 11. ZeroLeak7 Lv 1 72 pts. 9,894
  2. Avatar for Scopper 12. Scopper Lv 1 69 pts. 9,894
  3. Avatar for Galaxie 13. Galaxie Lv 1 67 pts. 9,888
  4. Avatar for reefyrob 14. reefyrob Lv 1 65 pts. 9,884
  5. Avatar for gitwut 15. gitwut Lv 1 62 pts. 9,876
  6. Avatar for Norrjane 16. Norrjane Lv 1 60 pts. 9,874
  7. Avatar for kabubi 17. kabubi Lv 1 58 pts. 9,869
  8. Avatar for Bruno Kestemont 18. Bruno Kestemont Lv 1 56 pts. 9,867
  9. Avatar for smilingone 19. smilingone Lv 1 54 pts. 9,860
  10. Avatar for O Seki To 20. O Seki To Lv 1 52 pts. 9,859

Comments