Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for pmdpmd 21. pmdpmd Lv 1 57 pts. 8,570
  2. Avatar for Scopper 22. Scopper Lv 1 55 pts. 8,569
  3. Avatar for Blipperman 23. Blipperman Lv 1 54 pts. 8,567
  4. Avatar for Jim Fraser 24. Jim Fraser Lv 1 52 pts. 8,564
  5. Avatar for reefyrob 25. reefyrob Lv 1 50 pts. 8,562
  6. Avatar for christioanchauvin 26. christioanchauvin Lv 1 49 pts. 8,562
  7. Avatar for Galaxie 27. Galaxie Lv 1 47 pts. 8,562
  8. Avatar for isaksson 28. isaksson Lv 1 46 pts. 8,561
  9. Avatar for Deleted player 29. Deleted player pts. 8,560
  10. Avatar for Timo van der Laan 30. Timo van der Laan Lv 1 43 pts. 8,557

Comments