Placeholder image of a protein
Icon representing a puzzle

1374: Revisiting Puzzle 109: Pumpkin

Closed since about 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 04, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a trypsin inhibitor in pumpkins. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been. Players will NOT be able to load in any previous solutions for these puzzles.



Sequence:


SSCPGKSSWPHLVGVGGSVAKAIIERQNPNVKAVILEEGTPVTK

Top groups


  1. Avatar for Contenders 100 pts. 8,626
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 8,618
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 8,617
  4. Avatar for Go Science 4. Go Science 38 pts. 8,610
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 27 pts. 8,607
  6. Avatar for Gargleblasters 6. Gargleblasters 18 pts. 8,591
  7. Avatar for HMT heritage 7. HMT heritage 12 pts. 8,582
  8. Avatar for Void Crushers 8. Void Crushers 8 pts. 8,557
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,525
  10. Avatar for Russian team 10. Russian team 3 pts. 8,522

  1. Avatar for guineapig 41. guineapig Lv 1 30 pts. 8,517
  2. Avatar for fiendish_ghoul 42. fiendish_ghoul Lv 1 29 pts. 8,512
  3. Avatar for johnmitch 43. johnmitch Lv 1 28 pts. 8,508
  4. Avatar for bcre8tvv 44. bcre8tvv Lv 1 27 pts. 8,502
  5. Avatar for pvc78 45. pvc78 Lv 1 26 pts. 8,501
  6. Avatar for Merf 46. Merf Lv 1 25 pts. 8,499
  7. Avatar for Museka 47. Museka Lv 1 24 pts. 8,498
  8. Avatar for toshiue 48. toshiue Lv 1 24 pts. 8,494
  9. Avatar for johngran 49. johngran Lv 1 23 pts. 8,484
  10. Avatar for diamonddays 50. diamonddays Lv 1 22 pts. 8,477

Comments