Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Iron pet 91. Iron pet Lv 1 2 pts. 8,800
  2. Avatar for stomjoh 92. stomjoh Lv 1 2 pts. 8,799
  3. Avatar for senor pit 93. senor pit Lv 1 2 pts. 8,794
  4. Avatar for benrh 94. benrh Lv 1 2 pts. 8,781
  5. Avatar for ViJay7019 95. ViJay7019 Lv 1 2 pts. 8,778
  6. Avatar for Bobnine 96. Bobnine Lv 1 2 pts. 8,771
  7. Avatar for uihcv 97. uihcv Lv 1 2 pts. 8,752
  8. Avatar for Mr_Jolty 98. Mr_Jolty Lv 1 2 pts. 8,732
  9. Avatar for alcor29 99. alcor29 Lv 1 1 pt. 8,725
  10. Avatar for Simek 100. Simek Lv 1 1 pt. 8,722

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).