Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for lamoille 141. lamoille Lv 1 1 pt. 8,152
  2. Avatar for cherry39 142. cherry39 Lv 1 1 pt. 8,136
  3. Avatar for spvincent 143. spvincent Lv 1 1 pt. 8,130
  4. Avatar for muffnerk 144. muffnerk Lv 1 1 pt. 8,061
  5. Avatar for NotJim99 145. NotJim99 Lv 1 1 pt. 8,049
  6. Avatar for pablokkk 146. pablokkk Lv 1 1 pt. 8,043
  7. Avatar for Gorkasmatzaile 147. Gorkasmatzaile Lv 1 1 pt. 8,025
  8. Avatar for parsnip 148. parsnip Lv 1 1 pt. 7,978
  9. Avatar for MicheleVerret 149. MicheleVerret Lv 1 1 pt. 7,955
  10. Avatar for Cerzax 150. Cerzax Lv 1 1 pt. 7,889

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).