Placeholder image of a protein
Icon representing a puzzle

1376: Revisiting Puzzle 110: Turkey

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 11, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This is a portion of a troponin protein found in the skeletal muscle of turkeys. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AFLSEEMIAEFKAAFDMFDADGGGDISTKELGTVMRMLGQNPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMK

Top groups

  1. Avatar for freefolder 11. freefolder 1 pt. 8,920
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 8,732
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,570
  4. Avatar for Piratenpartei Deutschland 14. Piratenpartei Deutschland 1 pt. 8,523
  5. Avatar for DSN @ Home 15. DSN @ Home 1 pt. 7,878
  6. Avatar for Deleted group 16. Deleted group pts. 7,616
  1. Avatar for Jim Fraser 71. Jim Fraser Lv 1 6 pts. 8,929
  2. Avatar for MadCat08 72. MadCat08 Lv 1 6 pts. 8,927
  3. Avatar for Imeturoran 73. Imeturoran Lv 1 6 pts. 8,920
  4. Avatar for fpc 74. fpc Lv 1 6 pts. 8,915
  5. Avatar for Deleted player 75. Deleted player pts. 8,914
  6. Avatar for ManVsYard 76. ManVsYard Lv 1 5 pts. 8,903
  7. Avatar for ralan-nsk 77. ralan-nsk Lv 1 5 pts. 8,895
  8. Avatar for diamonddays 78. diamonddays Lv 1 4 pts. 8,892
  9. Avatar for bcre8tvv 79. bcre8tvv Lv 1 4 pts. 8,886
  10. Avatar for Datstandin 80. Datstandin Lv 1 4 pts. 8,879

Comments

actiasluna Lv 1

In game scoreboards not agreeing with puzzle page scores… again. 1378 isn't even loading players, and looks like when that happened the other 2 active puzzles stopped reporting back from foldit (or something).