Placeholder image of a protein
Icon representing a puzzle

1379: Revisiting Puzzle 111: Mouse

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
May 18, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is found in the nucleus of stem cells in mice, and is important for maintaining the pluripotency of the stem cell. The protein is modeled here as in a reduced environment, so no disulfide bonds are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


TVFSQAQLCALKDRFQKQKYLSLQQMQELSSILNLSYKQVKTWFQNQRMKCKRWQ

Top groups


  1. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 2 pts. 8,741
  2. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,728
  3. Avatar for Deleted group 14. Deleted group pts. 8,712
  4. Avatar for :) 15. :) 1 pt. 8,597
  5. Avatar for xkcd 16. xkcd 1 pt. 8,583
  6. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 8,544
  7. Avatar for Team South Africa 18. Team South Africa 1 pt. 8,415
  8. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 7,860

  1. Avatar for caglar 11. caglar Lv 1 73 pts. 8,905
  2. Avatar for pauldunn 12. pauldunn Lv 1 71 pts. 8,899
  3. Avatar for retiredmichael 13. retiredmichael Lv 1 68 pts. 8,898
  4. Avatar for Aubade01 14. Aubade01 Lv 1 66 pts. 8,892
  5. Avatar for O Seki To 15. O Seki To Lv 1 64 pts. 8,890
  6. Avatar for drjr 16. drjr Lv 1 62 pts. 8,888
  7. Avatar for Bletchley Park 17. Bletchley Park Lv 1 60 pts. 8,887
  8. Avatar for Grom 18. Grom Lv 1 58 pts. 8,887
  9. Avatar for smholst 19. smholst Lv 1 56 pts. 8,886
  10. Avatar for actiasluna 20. actiasluna Lv 1 54 pts. 8,874

Comments