Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups

  1. Avatar for Natural Abilities 11. Natural Abilities 1 pt. 8,728
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,591
  3. Avatar for Russian team 13. Russian team 1 pt. 8,405
  4. Avatar for Deleted group 14. Deleted group pts. 8,392
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,213
  6. Avatar for DSN @ Home 16. DSN @ Home 1 pt. 3,937
  1. Avatar for bertro 11. bertro Lv 1 72 pts. 9,470
  2. Avatar for Wilm 12. Wilm Lv 1 69 pts. 9,468
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 67 pts. 9,465
  4. Avatar for tony46 14. tony46 Lv 1 64 pts. 9,462
  5. Avatar for isaksson 15. isaksson Lv 1 62 pts. 9,462
  6. Avatar for hpaege 16. hpaege Lv 1 60 pts. 9,460
  7. Avatar for caglar 17. caglar Lv 1 58 pts. 9,457
  8. Avatar for pvc78 18. pvc78 Lv 1 56 pts. 9,450
  9. Avatar for LociOiling 19. LociOiling Lv 1 54 pts. 9,400
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 52 pts. 9,399

Comments