Placeholder image of a protein
Icon representing a puzzle

1381: Unsolved De-novo Freestyle 105

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
May 22, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TELEKHREELKEFLKKEGITNVEIRIDNGRLEVRVEGGTERLKRFLEELRQKLEKKGYTVDIKIE

Top groups


  1. Avatar for Beta Folders 100 pts. 9,518
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,511
  3. Avatar for Gargleblasters 3. Gargleblasters 49 pts. 9,496
  4. Avatar for Go Science 4. Go Science 33 pts. 9,485
  5. Avatar for Contenders 5. Contenders 22 pts. 9,330
  6. Avatar for Void Crushers 6. Void Crushers 14 pts. 9,248
  7. Avatar for HMT heritage 7. HMT heritage 8 pts. 9,190
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 5 pts. 9,157
  9. Avatar for freefolder 9. freefolder 3 pts. 9,151
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,986

  1. Avatar for bertro 11. bertro Lv 1 72 pts. 9,470
  2. Avatar for Wilm 12. Wilm Lv 1 69 pts. 9,468
  3. Avatar for fiendish_ghoul 13. fiendish_ghoul Lv 1 67 pts. 9,465
  4. Avatar for tony46 14. tony46 Lv 1 64 pts. 9,462
  5. Avatar for isaksson 15. isaksson Lv 1 62 pts. 9,462
  6. Avatar for hpaege 16. hpaege Lv 1 60 pts. 9,460
  7. Avatar for caglar 17. caglar Lv 1 58 pts. 9,457
  8. Avatar for pvc78 18. pvc78 Lv 1 56 pts. 9,450
  9. Avatar for LociOiling 19. LociOiling Lv 1 54 pts. 9,400
  10. Avatar for NinjaGreg 20. NinjaGreg Lv 1 52 pts. 9,399

Comments