Placeholder image of a protein
Icon representing a puzzle

1385: Revisiting Puzzle 113: White Birch

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
May 31, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is an allergen produced by the white birch tree. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


ADDHPQDKAERERIFKRFDANGDGKISAAELGEALKTLGSITPDEVKHMMAEIDTDGDGFISFQEFTDFGRANRGLLKDVAKIF

Top groups

  1. Avatar for Russian team 11. Russian team 1 pt. 9,151
  2. Avatar for xkcd 12. xkcd 1 pt. 9,043
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 9,028
  4. Avatar for Richard Dawkins Foundation 14. Richard Dawkins Foundation 1 pt. 8,764
  1. Avatar for jinhd6 141. jinhd6 Lv 1 1 pt. 8,396
  2. Avatar for DipsyDoodle2016 142. DipsyDoodle2016 Lv 1 1 pt. 8,349
  3. Avatar for emdee314 143. emdee314 Lv 1 1 pt. 8,319
  4. Avatar for Uttkarsh 144. Uttkarsh Lv 1 1 pt. 8,225
  5. Avatar for zhoulvyylj 145. zhoulvyylj Lv 1 1 pt. 8,213
  6. Avatar for 01010011111 146. 01010011111 Lv 1 1 pt. 7,579
  7. Avatar for DoctorSockrates 147. DoctorSockrates Lv 1 1 pt. 5,788
  8. Avatar for rachel580 148. rachel580 Lv 1 1 pt. 5,788

Comments