Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0

  1. Avatar for andrewtmaxwell 91. andrewtmaxwell Lv 1 2 pts. 9,070
  2. Avatar for ppp6 92. ppp6 Lv 1 2 pts. 9,044
  3. Avatar for Soggy Doglog 93. Soggy Doglog Lv 1 2 pts. 9,028
  4. Avatar for dbuske 94. dbuske Lv 1 2 pts. 8,994
  5. Avatar for Superphosphate 95. Superphosphate Lv 1 2 pts. 8,994
  6. Avatar for Imeturoran 96. Imeturoran Lv 1 2 pts. 8,968
  7. Avatar for benrh 97. benrh Lv 1 1 pt. 8,950
  8. Avatar for SuperEnzyme 98. SuperEnzyme Lv 1 1 pt. 8,947
  9. Avatar for rabamino12358 100. rabamino12358 Lv 1 1 pt. 8,932

Comments