Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for fpc 101. fpc Lv 1 1 pt. 8,928
  2. Avatar for Scopper 102. Scopper Lv 1 1 pt. 8,928
  3. Avatar for mitarcher 103. mitarcher Lv 1 1 pt. 8,920
  4. Avatar for Arne Heessels 104. Arne Heessels Lv 1 1 pt. 8,920
  5. Avatar for ManVsYard 105. ManVsYard Lv 1 1 pt. 8,918
  6. Avatar for hachem 106. hachem Lv 1 1 pt. 8,905
  7. Avatar for Jim Fraser 107. Jim Fraser Lv 1 1 pt. 8,900
  8. Avatar for jamiexq 108. jamiexq Lv 1 1 pt. 8,876
  9. Avatar for harvardman 109. harvardman Lv 1 1 pt. 8,842
  10. Avatar for navn 110. navn Lv 1 1 pt. 8,842

Comments