Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0

  1. Avatar for trentis1 121. trentis1 Lv 1 1 pt. 8,358
  2. Avatar for goldfish80 122. goldfish80 Lv 1 1 pt. 8,318
  3. Avatar for rsosborne 123. rsosborne Lv 1 1 pt. 8,254
  4. Avatar for kamilko 124. kamilko Lv 1 1 pt. 8,185
  5. Avatar for carsonfb 125. carsonfb Lv 1 1 pt. 8,026
  6. Avatar for NotJim99 126. NotJim99 Lv 1 1 pt. 7,960
  7. Avatar for lange 127. lange Lv 1 1 pt. 7,944
  8. Avatar for lamoille 128. lamoille Lv 1 1 pt. 7,749
  9. Avatar for boondog 129. boondog Lv 1 1 pt. 7,665
  10. Avatar for maman 130. maman Lv 1 1 pt. 7,521

Comments