Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for pnciaccia 141. pnciaccia Lv 1 1 pt. 6,803
  2. Avatar for SilvaTempus 142. SilvaTempus Lv 1 1 pt. 6,647
  3. Avatar for larry25427 143. larry25427 Lv 1 1 pt. 6,602
  4. Avatar for 181818 144. 181818 Lv 1 1 pt. 6,574
  5. Avatar for Ben24-19 145. Ben24-19 Lv 1 1 pt. 6,478
  6. Avatar for nevovob 146. nevovob Lv 1 1 pt. 6,265
  7. Avatar for groudit 147. groudit Lv 1 1 pt. 6,011
  8. Avatar for lilspy2 148. lilspy2 Lv 1 1 pt. 6,010
  9. Avatar for ibelle 149. ibelle Lv 1 1 pt. 5,475
  10. Avatar for DScott 150. DScott Lv 1 1 pt. 5,438

Comments