Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  6. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  7. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0

  1. Avatar for Mydogisa Toelicker 61. Mydogisa Toelicker Lv 1 10 pts. 9,235
  2. Avatar for pvc78 62. pvc78 Lv 1 9 pts. 9,234
  3. Avatar for jobo0502 63. jobo0502 Lv 1 9 pts. 9,228
  4. Avatar for deLaCeiba 64. deLaCeiba Lv 1 8 pts. 9,223
  5. Avatar for Norrjane 65. Norrjane Lv 1 8 pts. 9,219
  6. Avatar for uihcv 67. uihcv Lv 1 7 pts. 9,208
  7. Avatar for Mike Cassidy 68. Mike Cassidy Lv 1 7 pts. 9,202
  8. Avatar for alcor29 69. alcor29 Lv 1 6 pts. 9,200
  9. Avatar for ralan-nsk 70. ralan-nsk Lv 1 6 pts. 9,197

Comments