Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Russian team 11. Russian team 2 pts. 9,197
  2. Avatar for Natural Abilities 12. Natural Abilities 1 pt. 9,147
  3. Avatar for xkcd 13. xkcd 1 pt. 9,101
  4. Avatar for freefolder 14. freefolder 1 pt. 8,968
  5. Avatar for Richard Dawkins Foundation 15. Richard Dawkins Foundation 1 pt. 8,254
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 7,386
  7. Avatar for Team South Africa 17. Team South Africa 1 pt. 7,037
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 0
  1. Avatar for Merf 81. Merf Lv 1 3 pts. 9,147
  2. Avatar for SWR_DMaster 82. SWR_DMaster Lv 1 3 pts. 9,128
  3. Avatar for spritz1992 83. spritz1992 Lv 1 3 pts. 9,125
  4. Avatar for bcre8tvv 84. bcre8tvv Lv 1 3 pts. 9,118
  5. Avatar for alwen 85. alwen Lv 1 3 pts. 9,116
  6. Avatar for fryguy 86. fryguy Lv 1 3 pts. 9,101
  7. Avatar for YeshuaLives 87. YeshuaLives Lv 1 2 pts. 9,098
  8. Avatar for tomespen 88. tomespen Lv 1 2 pts. 9,095
  9. Avatar for drjr 89. drjr Lv 1 2 pts. 9,093
  10. Avatar for lupussapien 90. lupussapien Lv 1 2 pts. 9,087

Comments