Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223
  1. Avatar for bitwave 131. bitwave Lv 1 1 pt. 7,514
  2. Avatar for cnhrcolemam 132. cnhrcolemam Lv 1 1 pt. 7,484
  3. Avatar for j.wohlmann 133. j.wohlmann Lv 1 1 pt. 7,461
  4. Avatar for mdhalloran 134. mdhalloran Lv 1 1 pt. 7,414
  5. Avatar for uitham 135. uitham Lv 1 1 pt. 7,386
  6. Avatar for deathbat_87 136. deathbat_87 Lv 1 1 pt. 7,375
  7. Avatar for jybourque 137. jybourque Lv 1 1 pt. 7,154
  8. Avatar for doctaven 138. doctaven Lv 1 1 pt. 7,037
  9. Avatar for sarahlav7 139. sarahlav7 Lv 1 1 pt. 6,911
  10. Avatar for RealCold 140. RealCold Lv 1 1 pt. 6,854

Comments