Placeholder image of a protein
Icon representing a puzzle

1387: Unsolved De-novo Freestyle 106

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 06, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


SEFQKEMKKLEETLKKGDEETFRELLKELEKRVREHGREDYKEILKRLREYLEKGDKESLQRLFEETKKS

Top groups


  1. Avatar for Go Science 100 pts. 9,758
  2. Avatar for Gargleblasters 2. Gargleblasters 74 pts. 9,732
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,731
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 38 pts. 9,721
  5. Avatar for Contenders 5. Contenders 27 pts. 9,678
  6. Avatar for Void Crushers 6. Void Crushers 18 pts. 9,468
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 12 pts. 9,464
  8. Avatar for Marvin's bunch 8. Marvin's bunch 8 pts. 9,365
  9. Avatar for HMT heritage 9. HMT heritage 5 pts. 9,338
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 3 pts. 9,223

  1. Avatar for smit1892 151. smit1892 Lv 1 1 pt. 5,248
  2. Avatar for vasya_lebedev 152. vasya_lebedev Lv 1 1 pt. 4,991
  3. Avatar for aepatis94 154. aepatis94 Lv 1 1 pt. 0
  4. Avatar for aspadistra 155. aspadistra Lv 1 1 pt. 0
  5. Avatar for dsilverb 156. dsilverb Lv 1 1 pt. 0
  6. Avatar for jeff101 157. jeff101 Lv 1 1 pt. 0
  7. Avatar for Hollinas 158. Hollinas Lv 1 1 pt. 0

Comments