Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 9,848
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,829
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,510
  4. Avatar for xkcd 14. xkcd 1 pt. 9,284
  5. Avatar for Piratenpartei Deutschland 15. Piratenpartei Deutschland 1 pt. 9,021
  6. Avatar for freefolder 16. freefolder 1 pt. 8,724
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,602
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 8,598
  9. Avatar for UWO CHEM365 S2017 19. UWO CHEM365 S2017 1 pt. 7,949
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,902
  1. Avatar for MadCat08 121. MadCat08 Lv 1 1 pt. 8,663
  2. Avatar for j.wohlmann 122. j.wohlmann Lv 1 1 pt. 8,659
  3. Avatar for NotJim99 123. NotJim99 Lv 1 1 pt. 8,644
  4. Avatar for a791412276 124. a791412276 Lv 1 1 pt. 8,635
  5. Avatar for dr nips 125. dr nips Lv 1 1 pt. 8,634
  6. Avatar for groudit 126. groudit Lv 1 1 pt. 8,633
  7. Avatar for Ref_Jo 127. Ref_Jo Lv 1 1 pt. 8,625
  8. Avatar for Deleted player 128. Deleted player pts. 8,608
  9. Avatar for amrull 129. amrull Lv 1 1 pt. 8,606
  10. Avatar for uitham 130. uitham Lv 1 1 pt. 8,602

Comments