Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924
  1. Avatar for MadCat08 121. MadCat08 Lv 1 1 pt. 8,663
  2. Avatar for j.wohlmann 122. j.wohlmann Lv 1 1 pt. 8,659
  3. Avatar for NotJim99 123. NotJim99 Lv 1 1 pt. 8,644
  4. Avatar for a791412276 124. a791412276 Lv 1 1 pt. 8,635
  5. Avatar for dr nips 125. dr nips Lv 1 1 pt. 8,634
  6. Avatar for groudit 126. groudit Lv 1 1 pt. 8,633
  7. Avatar for Ref_Jo 127. Ref_Jo Lv 1 1 pt. 8,625
  8. Avatar for Deleted player 128. Deleted player pts. 8,608
  9. Avatar for amrull 129. amrull Lv 1 1 pt. 8,606
  10. Avatar for uitham 130. uitham Lv 1 1 pt. 8,602

Comments