Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 9,848
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,829
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,510
  4. Avatar for xkcd 14. xkcd 1 pt. 9,284
  5. Avatar for Piratenpartei Deutschland 15. Piratenpartei Deutschland 1 pt. 9,021
  6. Avatar for freefolder 16. freefolder 1 pt. 8,724
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,602
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 8,598
  9. Avatar for UWO CHEM365 S2017 19. UWO CHEM365 S2017 1 pt. 7,949
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,902
  1. Avatar for Franco Padelletti 151. Franco Padelletti Lv 1 1 pt. 8,122
  2. Avatar for jj4577 152. jj4577 Lv 1 1 pt. 8,057
  3. Avatar for aepatis94 153. aepatis94 Lv 1 1 pt. 8,042
  4. Avatar for Superphosphate 154. Superphosphate Lv 1 1 pt. 7,957
  5. Avatar for koehlr60chem365 155. koehlr60chem365 Lv 1 1 pt. 7,949
  6. Avatar for Jaime_Navarrete 156. Jaime_Navarrete Lv 1 1 pt. 7,844
  7. Avatar for Thao Vang 157. Thao Vang Lv 1 1 pt. 7,422
  8. Avatar for tony46 158. tony46 Lv 1 1 pt. 7,115
  9. Avatar for spvincent 159. spvincent Lv 1 1 pt. 6,902
  10. Avatar for doctaven 160. doctaven Lv 1 1 pt. 6,902

Comments