Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924
  1. Avatar for Franco Padelletti 151. Franco Padelletti Lv 1 1 pt. 8,122
  2. Avatar for jj4577 152. jj4577 Lv 1 1 pt. 8,057
  3. Avatar for aepatis94 153. aepatis94 Lv 1 1 pt. 8,042
  4. Avatar for Superphosphate 154. Superphosphate Lv 1 1 pt. 7,957
  5. Avatar for koehlr60chem365 155. koehlr60chem365 Lv 1 1 pt. 7,949
  6. Avatar for Jaime_Navarrete 156. Jaime_Navarrete Lv 1 1 pt. 7,844
  7. Avatar for Thao Vang 157. Thao Vang Lv 1 1 pt. 7,422
  8. Avatar for tony46 158. tony46 Lv 1 1 pt. 7,115
  9. Avatar for spvincent 159. spvincent Lv 1 1 pt. 6,902
  10. Avatar for doctaven 160. doctaven Lv 1 1 pt. 6,902

Comments