Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Russian team 11. Russian team 3 pts. 9,848
  2. Avatar for Natural Abilities 12. Natural Abilities 2 pts. 9,829
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 9,510
  4. Avatar for xkcd 14. xkcd 1 pt. 9,284
  5. Avatar for Piratenpartei Deutschland 15. Piratenpartei Deutschland 1 pt. 9,021
  6. Avatar for freefolder 16. freefolder 1 pt. 8,724
  7. Avatar for FoldIt@Netherlands 17. FoldIt@Netherlands 1 pt. 8,602
  8. Avatar for GUGITBIOTECH 18. GUGITBIOTECH 1 pt. 8,598
  9. Avatar for UWO CHEM365 S2017 19. UWO CHEM365 S2017 1 pt. 7,949
  10. Avatar for Team South Africa 20. Team South Africa 1 pt. 6,902
  1. Avatar for ralan-nsk 61. ralan-nsk Lv 1 10 pts. 9,848
  2. Avatar for eromana 62. eromana Lv 1 10 pts. 9,839
  3. Avatar for Mr_Jolty 63. Mr_Jolty Lv 1 9 pts. 9,829
  4. Avatar for smholst 64. smholst Lv 1 9 pts. 9,813
  5. Avatar for Fog Darts 65. Fog Darts Lv 1 9 pts. 9,804
  6. Avatar for Blipperman 66. Blipperman Lv 1 8 pts. 9,802
  7. Avatar for kamilko 67. kamilko Lv 1 8 pts. 9,800
  8. Avatar for Festering Wounds 68. Festering Wounds Lv 1 7 pts. 9,791
  9. Avatar for dizzywings 69. dizzywings Lv 1 7 pts. 9,764
  10. Avatar for carsonfb 70. carsonfb Lv 1 7 pts. 9,763

Comments