Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924

  1. Avatar for ralan-nsk 61. ralan-nsk Lv 1 10 pts. 9,848
  2. Avatar for eromana 62. eromana Lv 1 10 pts. 9,839
  3. Avatar for Mr_Jolty 63. Mr_Jolty Lv 1 9 pts. 9,829
  4. Avatar for smholst 64. smholst Lv 1 9 pts. 9,813
  5. Avatar for Fog Darts 65. Fog Darts Lv 1 9 pts. 9,804
  6. Avatar for Blipperman 66. Blipperman Lv 1 8 pts. 9,802
  7. Avatar for kamilko 67. kamilko Lv 1 8 pts. 9,800
  8. Avatar for Festering Wounds 68. Festering Wounds Lv 1 7 pts. 9,791
  9. Avatar for dizzywings 69. dizzywings Lv 1 7 pts. 9,764
  10. Avatar for carsonfb 70. carsonfb Lv 1 7 pts. 9,763

Comments