Placeholder image of a protein
Icon representing a puzzle

1388: Revisiting Puzzle 114: Black Mamba

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 07, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This toxin is produced in the intestines of the African black mamba. The protein contains ten cysteines that oxidize to form five disulfide bonds. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


AVITGACERDLQCGKGTCCAVSLWIKSVRVCTPVGTSGEDCHPASHKIPFSGQRMHHTCPCAPNLACVQTSPKKFKCLSK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 10,297
  2. Avatar for Beta Folders 2. Beta Folders 77 pts. 10,248
  3. Avatar for Contenders 3. Contenders 58 pts. 10,221
  4. Avatar for Gargleblasters 4. Gargleblasters 43 pts. 10,204
  5. Avatar for Go Science 5. Go Science 31 pts. 10,186
  6. Avatar for Void Crushers 6. Void Crushers 22 pts. 10,152
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 15 pts. 10,151
  8. Avatar for Marvin's bunch 8. Marvin's bunch 11 pts. 10,090
  9. Avatar for HMT heritage 9. HMT heritage 7 pts. 10,050
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 5 pts. 9,924
  1. Avatar for Deleted player 91. Deleted player pts. 9,186
  2. Avatar for Grom 92. Grom Lv 1 2 pts. 9,133
  3. Avatar for roman madala 93. roman madala Lv 1 2 pts. 9,031
  4. Avatar for versat82 94. versat82 Lv 1 2 pts. 9,021
  5. Avatar for drjr 95. drjr Lv 1 2 pts. 9,018
  6. Avatar for mitarcher 96. mitarcher Lv 1 2 pts. 9,014
  7. Avatar for rabamino12358 97. rabamino12358 Lv 1 2 pts. 9,006
  8. Avatar for jamiexq 98. jamiexq Lv 1 2 pts. 8,991
  9. Avatar for Merf 99. Merf Lv 1 1 pt. 8,961
  10. Avatar for jebbiek 100. jebbiek Lv 1 1 pt. 8,933

Comments