Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for lastspirit 111. lastspirit Lv 1 1 pt. 8,724
  2. Avatar for NinguLilium 112. NinguLilium Lv 1 1 pt. 8,704
  3. Avatar for momadoc 113. momadoc Lv 1 1 pt. 8,703
  4. Avatar for cherry39 114. cherry39 Lv 1 1 pt. 8,700
  5. Avatar for Arne Heessels 115. Arne Heessels Lv 1 1 pt. 8,693
  6. Avatar for EvENinG_TtiMe 116. EvENinG_TtiMe Lv 1 1 pt. 8,677
  7. Avatar for sygel 117. sygel Lv 1 1 pt. 8,676
  8. Avatar for navn 118. navn Lv 1 1 pt. 8,669
  9. Avatar for MadCat08 119. MadCat08 Lv 1 1 pt. 8,658
  10. Avatar for awes0meb0y 120. awes0meb0y Lv 1 1 pt. 8,650

Comments