Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Richard Dawkins Foundation 11. Richard Dawkins Foundation 1 pt. 9,051
  2. Avatar for xkcd 12. xkcd 1 pt. 8,982
  3. Avatar for Natural Abilities 13. Natural Abilities 1 pt. 8,982
  4. Avatar for IEGS Biochemistry 14. IEGS Biochemistry 1 pt. 8,605
  5. Avatar for GUGITBIOTECH 15. GUGITBIOTECH 1 pt. 7,913
  6. Avatar for Window Group 16. Window Group 1 pt. 6,662
  1. Avatar for toshiue 61. toshiue Lv 1 7 pts. 9,200
  2. Avatar for Superphosphate 62. Superphosphate Lv 1 7 pts. 9,193
  3. Avatar for dbuske 63. dbuske Lv 1 6 pts. 9,184
  4. Avatar for ProHarTius 64. ProHarTius Lv 1 6 pts. 9,180
  5. Avatar for ViJay7019 65. ViJay7019 Lv 1 6 pts. 9,170
  6. Avatar for manu8170 66. manu8170 Lv 1 5 pts. 9,149
  7. Avatar for stomjoh 67. stomjoh Lv 1 5 pts. 9,142
  8. Avatar for alcor29 68. alcor29 Lv 1 5 pts. 9,132
  9. Avatar for johngran 69. johngran Lv 1 4 pts. 9,110
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 4 pts. 9,102

Comments