Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since almost 9 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,615
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,613
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 9,609
  4. Avatar for Go Science 4. Go Science 33 pts. 9,608
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,596
  6. Avatar for Contenders 6. Contenders 14 pts. 9,583
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,456
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,387
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 9,351
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,290

  1. Avatar for toshiue 61. toshiue Lv 1 7 pts. 9,200
  2. Avatar for Superphosphate 62. Superphosphate Lv 1 7 pts. 9,193
  3. Avatar for dbuske 63. dbuske Lv 1 6 pts. 9,184
  4. Avatar for ProHarTius 64. ProHarTius Lv 1 6 pts. 9,180
  5. Avatar for ViJay7019 65. ViJay7019 Lv 1 6 pts. 9,170
  6. Avatar for manu8170 66. manu8170 Lv 1 5 pts. 9,149
  7. Avatar for stomjoh 67. stomjoh Lv 1 5 pts. 9,142
  8. Avatar for alcor29 68. alcor29 Lv 1 5 pts. 9,132
  9. Avatar for johngran 69. johngran Lv 1 4 pts. 9,110
  10. Avatar for Mike Cassidy 70. Mike Cassidy Lv 1 4 pts. 9,102

Comments