Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,615
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,613
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 9,609
  4. Avatar for Go Science 4. Go Science 33 pts. 9,608
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,596
  6. Avatar for Contenders 6. Contenders 14 pts. 9,583
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,456
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,387
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 9,351
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,290

  1. Avatar for joremen 31. joremen Lv 1 31 pts. 9,419
  2. Avatar for O Seki To 32. O Seki To Lv 1 30 pts. 9,387
  3. Avatar for cobaltteal 33. cobaltteal Lv 1 28 pts. 9,381
  4. Avatar for hansvandenhof 34. hansvandenhof Lv 1 27 pts. 9,377
  5. Avatar for phi16 35. phi16 Lv 1 26 pts. 9,377
  6. Avatar for crpainter 36. crpainter Lv 1 25 pts. 9,357
  7. Avatar for frood66 37. frood66 Lv 1 24 pts. 9,351
  8. Avatar for SaraL 38. SaraL Lv 1 23 pts. 9,343
  9. Avatar for MicElephant 39. MicElephant Lv 1 22 pts. 9,339
  10. Avatar for Merf 40. Merf Lv 1 21 pts. 9,333

Comments