Placeholder image of a protein
Icon representing a puzzle

1391: Revisiting Puzzle 115: Exocyst

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 15, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein is involved in the process of exocytosis, transporting proteins to the cell membrane or extracellular areas. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


HMRQPPLVTGISPNEGIPWTKVTIRGENLGTGPTDLIGLTICGHNCLLTAEWMSASKIVCRVGQAKNDKGDIIVTTKSGGKGTSTVSFKLLKPEK

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,615
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 71 pts. 9,613
  3. Avatar for Void Crushers 3. Void Crushers 49 pts. 9,609
  4. Avatar for Go Science 4. Go Science 33 pts. 9,608
  5. Avatar for Beta Folders 5. Beta Folders 22 pts. 9,596
  6. Avatar for Contenders 6. Contenders 14 pts. 9,583
  7. Avatar for L'Alliance Francophone 7. L'Alliance Francophone 8 pts. 9,456
  8. Avatar for HMT heritage 8. HMT heritage 5 pts. 9,387
  9. Avatar for Marvin's bunch 9. Marvin's bunch 3 pts. 9,351
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 9,290
  1. Avatar for lupussapien 51. lupussapien Lv 1 12 pts. 9,264
  2. Avatar for isaksson 52. isaksson Lv 1 11 pts. 9,251
  3. Avatar for actiasluna 53. actiasluna Lv 1 11 pts. 9,249
  4. Avatar for anthion 54. anthion Lv 1 10 pts. 9,248
  5. Avatar for diamonddays 55. diamonddays Lv 1 10 pts. 9,246
  6. Avatar for dizzywings 56. dizzywings Lv 1 9 pts. 9,243
  7. Avatar for Vinara 57. Vinara Lv 1 9 pts. 9,226
  8. Avatar for pvc78 58. pvc78 Lv 1 8 pts. 9,219
  9. Avatar for goldfish80 59. goldfish80 Lv 1 8 pts. 9,203
  10. Avatar for altejoh 60. altejoh Lv 1 7 pts. 9,201

Comments