Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for cherry39 121. cherry39 Lv 1 1 pt. 7,755
  2. Avatar for feand 122. feand Lv 1 1 pt. 7,718
  3. Avatar for Erica_W 123. Erica_W Lv 1 1 pt. 7,660
  4. Avatar for doctaven 124. doctaven Lv 1 1 pt. 7,436
  5. Avatar for DScott 125. DScott Lv 1 1 pt. 7,420
  6. Avatar for Jarda 126. Jarda Lv 1 1 pt. 7,294
  7. Avatar for metaphysics 127. metaphysics Lv 1 1 pt. 7,238
  8. Avatar for Firedest 128. Firedest Lv 1 1 pt. 7,221
  9. Avatar for sarahlav7 129. sarahlav7 Lv 1 1 pt. 6,954
  10. Avatar for mh123456 130. mh123456 Lv 1 1 pt. 6,919

Comments