Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for cherry39 121. cherry39 Lv 1 1 pt. 7,755
  2. Avatar for feand 122. feand Lv 1 1 pt. 7,718
  3. Avatar for Erica_W 123. Erica_W Lv 1 1 pt. 7,660
  4. Avatar for doctaven 124. doctaven Lv 1 1 pt. 7,436
  5. Avatar for DScott 125. DScott Lv 1 1 pt. 7,420
  6. Avatar for Jarda 126. Jarda Lv 1 1 pt. 7,294
  7. Avatar for metaphysics 127. metaphysics Lv 1 1 pt. 7,238
  8. Avatar for Firedest 128. Firedest Lv 1 1 pt. 7,221
  9. Avatar for sarahlav7 129. sarahlav7 Lv 1 1 pt. 6,954
  10. Avatar for mh123456 130. mh123456 Lv 1 1 pt. 6,919

Comments