Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for 1aries1 141. 1aries1 Lv 1 1 pt. 5,638
  2. Avatar for chongyukwai 142. chongyukwai Lv 1 1 pt. 5,342
  3. Avatar for utan 143. utan Lv 1 1 pt. 5,101
  4. Avatar for thomasMuender 144. thomasMuender Lv 1 1 pt. 5,019
  5. Avatar for rbsutton 145. rbsutton Lv 1 1 pt. 0
  6. Avatar for jeff101 146. jeff101 Lv 1 1 pt. 0
  7. Avatar for potatopotatopotato 147. potatopotatopotato Lv 1 1 pt. 0
  8. Avatar for Hollinas 148. Hollinas Lv 1 1 pt. 0
  9. Avatar for Dawit 149. Dawit Lv 1 1 pt. 0

Comments