Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for 1aries1 141. 1aries1 Lv 1 1 pt. 5,638
  2. Avatar for chongyukwai 142. chongyukwai Lv 1 1 pt. 5,342
  3. Avatar for utan 143. utan Lv 1 1 pt. 5,101
  4. Avatar for thomasMuender 144. thomasMuender Lv 1 1 pt. 5,019
  5. Avatar for rbsutton 145. rbsutton Lv 1 1 pt. 0
  6. Avatar for jeff101 146. jeff101 Lv 1 1 pt. 0
  7. Avatar for potatopotatopotato 147. potatopotatopotato Lv 1 1 pt. 0
  8. Avatar for Hollinas 148. Hollinas Lv 1 1 pt. 0
  9. Avatar for Dawit 149. Dawit Lv 1 1 pt. 0

Comments