Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for katling 41. katling Lv 1 21 pts. 9,187
  2. Avatar for Vinara 42. Vinara Lv 1 20 pts. 9,180
  3. Avatar for Bautho 43. Bautho Lv 1 19 pts. 9,178
  4. Avatar for pvc78 44. pvc78 Lv 1 18 pts. 9,175
  5. Avatar for christioanchauvin 45. christioanchauvin Lv 1 18 pts. 9,167
  6. Avatar for Glen B 46. Glen B Lv 1 17 pts. 9,165
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 16 pts. 9,163
  8. Avatar for spvincent 48. spvincent Lv 1 15 pts. 9,155
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 15 pts. 9,147
  10. Avatar for Bletchley Park 50. Bletchley Park Lv 1 14 pts. 9,143

Comments