Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225

  1. Avatar for katling 41. katling Lv 1 21 pts. 9,187
  2. Avatar for Vinara 42. Vinara Lv 1 20 pts. 9,180
  3. Avatar for Bautho 43. Bautho Lv 1 19 pts. 9,178
  4. Avatar for pvc78 44. pvc78 Lv 1 18 pts. 9,175
  5. Avatar for christioanchauvin 45. christioanchauvin Lv 1 18 pts. 9,167
  6. Avatar for Glen B 46. Glen B Lv 1 17 pts. 9,165
  7. Avatar for WBarme1234 47. WBarme1234 Lv 1 16 pts. 9,163
  8. Avatar for spvincent 48. spvincent Lv 1 15 pts. 9,155
  9. Avatar for TastyMunchies 49. TastyMunchies Lv 1 15 pts. 9,147
  10. Avatar for Bletchley Park 50. Bletchley Park Lv 1 14 pts. 9,143

Comments