Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for Mike Cassidy 51. Mike Cassidy Lv 1 13 pts. 9,140
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 13 pts. 9,136
  3. Avatar for Museka 53. Museka Lv 1 12 pts. 9,122
  4. Avatar for tarimo 54. tarimo Lv 1 11 pts. 9,121
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 11 pts. 9,114
  6. Avatar for georg137 56. georg137 Lv 1 10 pts. 9,113
  7. Avatar for dizzywings 57. dizzywings Lv 1 10 pts. 9,113
  8. Avatar for heather-1 58. heather-1 Lv 1 9 pts. 9,101
  9. Avatar for Deleted player 59. Deleted player pts. 9,094
  10. Avatar for dssb 60. dssb Lv 1 8 pts. 9,079

Comments