Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for Mike Cassidy 51. Mike Cassidy Lv 1 13 pts. 9,140
  2. Avatar for hansvandenhof 52. hansvandenhof Lv 1 13 pts. 9,136
  3. Avatar for Museka 53. Museka Lv 1 12 pts. 9,122
  4. Avatar for tarimo 54. tarimo Lv 1 11 pts. 9,121
  5. Avatar for Anfinsen_slept_here 55. Anfinsen_slept_here Lv 1 11 pts. 9,114
  6. Avatar for georg137 56. georg137 Lv 1 10 pts. 9,113
  7. Avatar for dizzywings 57. dizzywings Lv 1 10 pts. 9,113
  8. Avatar for heather-1 58. heather-1 Lv 1 9 pts. 9,101
  9. Avatar for Deleted player 59. Deleted player pts. 9,094
  10. Avatar for dssb 60. dssb Lv 1 8 pts. 9,079

Comments