Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for harvardman 61. harvardman Lv 1 8 pts. 9,071
  2. Avatar for deLaCeiba 62. deLaCeiba Lv 1 8 pts. 9,041
  3. Avatar for alcor29 63. alcor29 Lv 1 7 pts. 9,034
  4. Avatar for diamonddays 64. diamonddays Lv 1 7 pts. 9,027
  5. Avatar for stomjoh 65. stomjoh Lv 1 6 pts. 9,020
  6. Avatar for uihcv 66. uihcv Lv 1 6 pts. 9,016
  7. Avatar for saksoft2 67. saksoft2 Lv 1 6 pts. 9,013
  8. Avatar for andrewtmaxwell 68. andrewtmaxwell Lv 1 5 pts. 9,013
  9. Avatar for guineapig 69. guineapig Lv 1 5 pts. 8,998
  10. Avatar for alwen 70. alwen Lv 1 5 pts. 8,985

Comments