Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for harvardman 61. harvardman Lv 1 8 pts. 9,071
  2. Avatar for deLaCeiba 62. deLaCeiba Lv 1 8 pts. 9,041
  3. Avatar for alcor29 63. alcor29 Lv 1 7 pts. 9,034
  4. Avatar for diamonddays 64. diamonddays Lv 1 7 pts. 9,027
  5. Avatar for stomjoh 65. stomjoh Lv 1 6 pts. 9,020
  6. Avatar for uihcv 66. uihcv Lv 1 6 pts. 9,016
  7. Avatar for saksoft2 67. saksoft2 Lv 1 6 pts. 9,013
  8. Avatar for andrewtmaxwell 68. andrewtmaxwell Lv 1 5 pts. 9,013
  9. Avatar for guineapig 69. guineapig Lv 1 5 pts. 8,998
  10. Avatar for alwen 70. alwen Lv 1 5 pts. 8,985

Comments