Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for Richard Dawkins Foundation 13. Richard Dawkins Foundation 1 pt. 8,453
  4. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  5. Avatar for Deleted group 15. Deleted group pts. 7,660
  6. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  7. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309
  8. Avatar for Texas Tech Red Folders 18. Texas Tech Red Folders 1 pt. 0
  1. Avatar for ViJay7019 71. ViJay7019 Lv 1 5 pts. 8,983
  2. Avatar for SWR_DMaster 72. SWR_DMaster Lv 1 4 pts. 8,973
  3. Avatar for jobo0502 73. jobo0502 Lv 1 4 pts. 8,965
  4. Avatar for fishercat 74. fishercat Lv 1 4 pts. 8,964
  5. Avatar for YGK 75. YGK Lv 1 4 pts. 8,950
  6. Avatar for Deleted player 76. Deleted player pts. 8,941
  7. Avatar for tomespen 77. tomespen Lv 1 3 pts. 8,925
  8. Avatar for SaraL 78. SaraL Lv 1 3 pts. 8,917
  9. Avatar for Deleted player 79. Deleted player 3 pts. 8,911
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 3 pts. 8,895

Comments