Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Anthropic Dreams 100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225

  1. Avatar for ViJay7019 71. ViJay7019 Lv 1 5 pts. 8,983
  2. Avatar for SWR_DMaster 72. SWR_DMaster Lv 1 4 pts. 8,973
  3. Avatar for jobo0502 73. jobo0502 Lv 1 4 pts. 8,965
  4. Avatar for fishercat 74. fishercat Lv 1 4 pts. 8,964
  5. Avatar for YGK 75. YGK Lv 1 4 pts. 8,950
  6. Avatar for Deleted player 76. Deleted player pts. 8,941
  7. Avatar for tomespen 77. tomespen Lv 1 3 pts. 8,925
  8. Avatar for SaraL 78. SaraL Lv 1 3 pts. 8,917
  9. Avatar for Deleted player 79. Deleted player 3 pts. 8,911
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 3 pts. 8,895

Comments