Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since almost 9 years ago

Intermediate Overall Prediction

Summary


Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 2 pts. 9,041
  2. Avatar for Eὕρηκα! Heureka! 12. Eὕρηκα! Heureka! 1 pt. 8,590
  3. Avatar for DSN @ Home 14. DSN @ Home 1 pt. 7,841
  4. Avatar for Deleted group 15. Deleted group pts. 7,660
  5. Avatar for Team South Africa 16. Team South Africa 1 pt. 7,436
  6. Avatar for GUGITBIOTECH 17. GUGITBIOTECH 1 pt. 6,309

  1. Avatar for drjr 82. drjr Lv 1 2 pts. 8,852
  2. Avatar for benrh 83. benrh Lv 1 2 pts. 8,843
  3. Avatar for weitzen 84. weitzen Lv 1 2 pts. 8,827
  4. Avatar for carsonfb 85. carsonfb Lv 1 2 pts. 8,825
  5. Avatar for Jim Fraser 86. Jim Fraser Lv 1 2 pts. 8,825
  6. Avatar for froggs554 87. froggs554 Lv 1 2 pts. 8,780
  7. Avatar for boondog 88. boondog Lv 1 2 pts. 8,771
  8. Avatar for jamiexq 89. jamiexq Lv 1 2 pts. 8,770
  9. Avatar for Merf 90. Merf Lv 1 2 pts. 8,717

Comments