Placeholder image of a protein
Icon representing a puzzle

1393: Unsolved De-novo Freestyle 107

Closed since over 8 years ago

Intermediate Overall Prediction

Summary

Created
June 20, 2017
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


EKDEKIMEEMKKLVEQVKKKGGRVRITIRKENGTVRIRVEVDVDGHDTTVEWEGGSDDVMEHVKQQLQEVKDQHN

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,445
  2. Avatar for Beta Folders 2. Beta Folders 74 pts. 9,430
  3. Avatar for Void Crushers 3. Void Crushers 54 pts. 9,393
  4. Avatar for Marvin's bunch 4. Marvin's bunch 38 pts. 9,390
  5. Avatar for Go Science 5. Go Science 27 pts. 9,372
  6. Avatar for Contenders 6. Contenders 18 pts. 9,369
  7. Avatar for Gargleblasters 7. Gargleblasters 12 pts. 9,347
  8. Avatar for HMT heritage 8. HMT heritage 8 pts. 9,300
  9. Avatar for L'Alliance Francophone 9. L'Alliance Francophone 5 pts. 9,292
  10. Avatar for xkcd 10. xkcd 3 pts. 9,225
  1. Avatar for DAMilwaukeeWisconsin 81. DAMilwaukeeWisconsin Lv 1 3 pts. 8,889
  2. Avatar for drjr 82. drjr Lv 1 2 pts. 8,852
  3. Avatar for benrh 83. benrh Lv 1 2 pts. 8,843
  4. Avatar for weitzen 84. weitzen Lv 1 2 pts. 8,827
  5. Avatar for carsonfb 85. carsonfb Lv 1 2 pts. 8,825
  6. Avatar for Jim Fraser 86. Jim Fraser Lv 1 2 pts. 8,825
  7. Avatar for froggs554 87. froggs554 Lv 1 2 pts. 8,780
  8. Avatar for boondog 88. boondog Lv 1 2 pts. 8,771
  9. Avatar for jamiexq 89. jamiexq Lv 1 2 pts. 8,770
  10. Avatar for Merf 90. Merf Lv 1 2 pts. 8,717

Comments