Placeholder image of a protein
Icon representing a puzzle

1394: Revisiting Puzzle 117: Transport Mutant

Closed since over 8 years ago

Intermediate Overall Prediction

Summary


Created
June 22, 2017
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This small protein participates in electron transfer reactions in the cell. The protein is modeled here in reduced form, so no disulfides are expected to form. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

a
MKKYTCTVCGYIYNPEDGDPDNGVNPGTDFKDIPDDWVCPLCAVGKDQFEEVEE

Top groups


  1. Avatar for Contenders 100 pts. 8,848
  2. Avatar for Go Science 2. Go Science 73 pts. 8,848
  3. Avatar for HMT heritage 3. HMT heritage 52 pts. 8,848
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 36 pts. 8,844
  5. Avatar for Beta Folders 5. Beta Folders 24 pts. 8,841
  6. Avatar for Gargleblasters 6. Gargleblasters 16 pts. 8,818
  7. Avatar for Void Crushers 7. Void Crushers 10 pts. 8,816
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 6 pts. 8,786
  9. Avatar for Marvin's bunch 9. Marvin's bunch 4 pts. 8,757
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 2 pts. 8,754

  1. Avatar for reefyrob 21. reefyrob Lv 1 46 pts. 8,798
  2. Avatar for toshiue 22. toshiue Lv 1 44 pts. 8,798
  3. Avatar for joremen 23. joremen Lv 1 42 pts. 8,797
  4. Avatar for mimi 24. mimi Lv 1 40 pts. 8,795
  5. Avatar for MicElephant 25. MicElephant Lv 1 39 pts. 8,793
  6. Avatar for Blipperman 26. Blipperman Lv 1 37 pts. 8,791
  7. Avatar for dssb 27. dssb Lv 1 35 pts. 8,791
  8. Avatar for nicobul 28. nicobul Lv 1 34 pts. 8,786
  9. Avatar for tomespen 29. tomespen Lv 1 32 pts. 8,786
  10. Avatar for WBarme1234 30. WBarme1234 Lv 1 31 pts. 8,785

Comments